PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00011735-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SRS
Protein Properties Length: 346aa    MW: 37081.9 Da    PI: 7.7527
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00011735-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702227.52.5e-701182693154
              DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa....aeaaskrkrelkskkqsalsst 89 
                          g++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpa++rrerqqqlaa+++++++++    +  ++kr+r  ++  +s+l++t
  WALNUT_00011735-RA 118 GGGVSCQDCGNQAKKDCVHMRCRTCCKSRGFECQTHVKSTWVPASRRRERQQQLAAMQQQQQQHQqlqlHGVNPKRQR--ENPGSSSLACT 206
                         5789***************************************************99998888775643344444444..45788899999 PP

              DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                         +l+++   + le+ ++P+ev+s+avfrc+rvss+d++++++aYq+av+igGhvfkG+LydqG+e+
  WALNUT_00011735-RA 207 RLPTSA--SGLEVGHFPAEVNSPAVFRCIRVSSIDEADDQYAYQAAVNIGGHVFKGTLYDQGPET 269
                         998876..5699999************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.8E-67120268IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.8E-28122164IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.1E-26219267IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAGFFSLGGG RGTTSSSQDD RHRQSSNNPP TEIPQESLFW YKNDDPGYKG FELWQQQEQV  60
LLQHQQQQQQ RHHQQLQQDL YASAAGLGVG PSRSSINVSD ESPSRSAFMM MRSAGGGGGG  120
VSCQDCGNQA KKDCVHMRCR TCCKSRGFEC QTHVKSTWVP ASRRRERQQQ LAAMQQQQQQ  180
HQQLQLHGVN PKRQRENPGS SSLACTRLPT SASGLEVGHF PAEVNSPAVF RCIRVSSIDE  240
ADDQYAYQAA VNIGGHVFKG TLYDQGPETN YSIAGESSSG GGGGVQPLNL IAGVTNTSAT  300
TASGGGGGGA DVGSSAMTLL DPPSLYPGAP LNTFMAGTQF FPPPRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046785.11e-152Lateral root primordium protein-related, putative
SwissprotQ9SD401e-98SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A061DFV61e-152A0A061DFV6_THECC; Lateral root primordium protein-related, putative
STRINGVIT_04s0023g02780.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.18e-70Lateral root primordium (LRP) protein-related